PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG034628t1
Common NameTCM_034628
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family HD-ZIP
Protein Properties Length: 339aa    MW: 38233.4 Da    PI: 8.6984
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG034628t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.36.2e-19194248256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ +++keq  +Le+ F+++++++ ++++ LA++l+L  rqV vWFqNrRa+ k
  Thecc1EG034628t1 194 RKKLRLSKEQSAILEDSFKEHSTLNPKQKQLLAEQLNLRPRQVEVWFQNRRARTK 248
                       788899***********************************************98 PP

2HD-ZIP_I/II122.71.7e-39194282190
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                       +kk+rlskeq+++LE+sF+e+++L+p++K+ la++L+l+prqv+vWFqnrRARtk+kq+E+d+e Lk+++++l+een+rL+ke +eL+ +
  Thecc1EG034628t1 194 RKKLRLSKEQSAILEDSFKEHSTLNPKQKQLLAEQLNLRPRQVEVWFQNRRARTKLKQTEVDCELLKKCCETLTEENKRLQKELQELK-S 282
                       69*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.216190250IPR001356Homeobox domain
SuperFamilySSF466891.58E-18192258IPR009057Homeodomain-like
SMARTSM003896.6E-17192254IPR001356Homeobox domain
CDDcd000869.05E-17193251No hitNo description
Gene3DG3DSA:1.10.10.609.5E-18194248IPR009057Homeodomain-like
PfamPF000462.6E-16194248IPR001356Homeobox domain
PROSITE patternPS000270225248IPR017970Homeobox, conserved site
PfamPF021836.7E-9250283IPR003106Leucine zipper, homeobox-associated
SMARTSM003405.4E-21250293IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MSSGRNQVKV MSFSCKNNWA SFTRVYYLLE KQGMWWGTFG RSATRKTLFL FPPRHHDSVL  60
ASSFEQHLVL TTMGFDDFCN TGLGLGIGCL VKQEKFSQSD HQQKKKKLFL KHDHFFPSLT  120
LGPSDDIYQS ATKIDASKAH GESMDLHQQG SSLSAVSSFS NSSVKKERDF GGEEVELERV  180
SSRVSDEDEE GSPRKKLRLS KEQSAILEDS FKEHSTLNPK QKQLLAEQLN LRPRQVEVWF  240
QNRRARTKLK QTEVDCELLK KCCETLTEEN KRLQKELQEL KSLKLTASYC MQLPAATLTM  300
CPSCERVASG GEGPSTSPFT IGQKSHFFNP FTHPSAAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1242250RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007018400.10.0HD domain class transcription factor
SwissprotP466042e-84HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA0A061FE720.0A0A061FE72_THECC; HD domain class transcription factor
STRINGVIT_18s0001g08410.t011e-120(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16712886
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.12e-65HD-ZIP family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]